PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009784435.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 278aa    MW: 31812.8 Da    PI: 6.6639
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009784435.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS258.13.2e-79327696374
            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLa.sRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl 189
                     ++  qaI e v+g++++H +Df+i  G+Q   L+qaLa +R+++   l+iT++g+   ++ke++eetg+rL++fA++l++pf+fn++ +++++dl
  XP_009784435.1   3 FAGVQAIIENVKGATKIHLVDFNIRTGIQCTGLMQALAeQRDHPIELLKITAIGH---QEKEKIEETGKRLQSFANSLNLPFSFNIVFMSDMKDL 94 
                     7788**********************************66668888*********...579********************************** PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                     ++e+ +vk +E++aV + + l ++     + +++ d++++++++l+P vvvv+e ea+hns+sFl+rf+eal +ys+lfd++e  + r++  r+ 
  XP_009784435.1  95 RVESVNVKADETVAVYCNIVLRTMI----CRPEYMDNTMRVIRGLRPSVVVVCEVEANHNSPSFLNRFVEALFFYSVLFDCFEDCMDRDNLVRKR 185
                     ************************9....55666667********************************************************** PP

            GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +E + +g+ i+n+va+egaer+ r+ +l  Wr+ + ++G+ +++lse+   qa+l+l++++ +   +v+++ ++l+ gWk+ p+ svS W+
  XP_009784435.1 186 IEVFHIGEGIRNMVAAEGAERFTRNMKLDVWRAYFARFGMVEMELSESSWYQANLILKQFSqGSSCNVQNDGKALLVGWKGTPIESVSIWK 276
                     *************************************************************88889************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098538.8751255IPR005202Transcription factor GRAS
PfamPF035141.1E-763276IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MQFAGVQAII ENVKGATKIH LVDFNIRTGI QCTGLMQALA EQRDHPIELL KITAIGHQEK  60
EKIEETGKRL QSFANSLNLP FSFNIVFMSD MKDLRVESVN VKADETVAVY CNIVLRTMIC  120
RPEYMDNTMR VIRGLRPSVV VVCEVEANHN SPSFLNRFVE ALFFYSVLFD CFEDCMDRDN  180
LVRKRIEVFH IGEGIRNMVA AEGAERFTRN MKLDVWRAYF ARFGMVEMEL SESSWYQANL  240
ILKQFSQGSS CNVQNDGKAL LVGWKGTPIE SVSIWKFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-34727699375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755180.0HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009784435.10.0PREDICTED: DELLA protein GAI1-like
TrEMBLM1AB560.0M1AB56_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000187920.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.12e-48RGA-like 1